PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000148.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 263aa    MW: 29825.5 Da    PI: 9.0984
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000148.1_g00022.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.52.8e-3292144457
              ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                              +rY+eClkNhAas+Ggh++DGCgEfmps geegt++alkCaAC+CHRnFHR+  
  Itr_sc000148.1_g00022.1  92 IRYRECLKNHAASTGGHVTDGCGEFMPS-GEEGTPEALKCAACNCHRNFHRKGI 144
                              79*************************9.999*******************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2192142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-3092142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.6E-3093143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.59294143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.56E-19189260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-30191261IPR009057Homeodomain-like
PROSITE profilePS500718.697197261IPR001356Homeobox domain
TIGRFAMsTIGR015652.3E-27199256IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MESRSKEKFE GIPRSMAFSP HPPSRINLQA QEPSSQQTLD QMGEKELEHH HMHEGPSNPD  60
PDPSLLNNKP TTQQVLPQRF ADTDTSDTTT LIRYRECLKN HAASTGGHVT DGCGEFMPSG  120
EEGTPEALKC AACNCHRNFH RKGIRHGRST FHTQNPPMPP QQQHFRGAMP PPIRAPAESS  180
SEDLNAGGGQ GLMQVPSSKK RFRTKFTQQQ KQQMHEFAEK IGWRIQKQDD QEVHKFCSEV  240
GVKRQVFKVW MHNSKQAEKK KQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-221982571675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603276.16e-84PREDICTED: zinc-finger homeodomain protein 6-like
RefseqXP_016451406.16e-84PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW78e-61ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH15e-76M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090331e-75(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-51homeobox protein 24